SSGCID - MygeA.00076.a Uracil phosphoribosyltransferase MG_030

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10521CompleteStructure predictionssgcidSSGCID - MygeA.00076.a Ur...2064 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    . 
   sequence: MIKKVQHALILNELTKLRDKNTTTSQFRMALNQITSLLFFEATKQLPLATVEVETPFAKTKGYKLKNDIVLVPIMRAGLGMIDAIVRYSDKIRVGHLGIYRQTQTTSVISYYKKMPENISDSHVIILDPMLATGTTLLTAIKSIKEDKPIKISVIAIVAAPEGINKVEKMHPHVDIFLAAIDEKLNDNRYIIPGLGDAGDRLFGTK
    psipred: -EEEE---HHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH------EEEEE---------EEE--EEEEEEE-----HHHHHHHH----EEEEEEE---------EEEEE-----HHH--EEEE--------HHHHHHHHHHH----EEEEEEEEE-HHHHHHHHHH-----EEEEE--------------------------
    spider3: --EE---HHHHHHHHHH------HHHHHHHHHHHHHHHHHHHH-----EEEEEE----EEEEEEE---EEEEEEE---HHHHHHHHHH----EEEEEEEEE------EEEEEEE--------EEEEEE------HHHHHHHHHHHH----EEEEEEEEE-HHHHHHHHHH-----EEEEEE----------------HHHHHH---
 deepconcnf: -EEEE--HHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH-----EEEEEE---------EE---EEEEEE------HHHHHHHH-----EEEEEEEEE-----EEEEEEE--------EEEEE-------HHHHHHHHHHH-----EEEEEEEE--HHHHHHHHHH----EEEEEE---------EEE--------------
   disopred: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10890111.00comparative modeling1-20620610 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington