SSGCID - MygeA.20029.a Uncharacterized protein MG208 MG_208

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10520CompleteStructure predictionssgcidSSGCID - MygeA.20029.a Un...1964 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    . 
   sequence: MFFLSKYKLFLDCAYKTLNIIILEMKTNAVVDELSIGVEQNLTELAVYYLETMLTKNKLKKSSIKQFYVTIGPGSFTGQRIATIIAKSWCLLYPSCELYALNSLRFQIPYEHGISKISCGNDQNYCGLYSQTTSEIKLISKADFVKLCKANNELPMYENFENIESYSKLLLSNIDHFERIEDPLTLQPIYLKDPVN
    spider3: -------EEEEEE-----EEEEEEE----EEEEEEE-----HHHHHHHHHHHHHHH----HHH--EEEEE----HHHHHHHHHHHHHHHHHH-----EEEEHHHHHHHH--EEEEEEE----EEEEEEEE-----EEEE-HHHHHHHHH----EEEE-----HHHHHHHHHHHHHH------HHH-----------
 deepconcnf: ------EEEEEEE---EEEEEEEE----EEEEEEEE-----HHHHHHHHHHHHHHH---------EEEEE-----HHHHHHHHHHHHHHHHH-----EEEE-----------EEEEEE-----EEEEEE--------E--HHHHHHHHHH---EEEE-----HHHHHHHHHHHHHH--------------------
    psipred: -HHHHHHHHHHHH----EEEEEEE-----EEEEEE-------HHHHHHHHHHHHHH----HHH--EEEE------HHHHHHHHHHHHHHHHH-----EEEHHHHHHHHH---EEEEEE------HHHHH-------EE--HHHHHHHHH---EEEEE-----HHHHHHHHHHHHHHHH------EE----------
   disopred: DD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10889110.79comparative modeling1-19619610 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington