SSGCID - MygeA.19979.a Uncharacterized protein MG141.1 MG_477

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10519CompleteStructure predictionssgcidSSGCID - MygeA.19979.a Un...904 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
   sequence: MQLITRLCLLTRKHFVKRELLRLVKLDNQLEIDLNQNLKGRGYYLSVFGLKLDKKHLKAVVEKHLKVSCNDAKLTAMITALQQLAQDEKK
    psipred: ----------------HHH-EEEEEE--EEEE---------EEEE---HHHHHHHHHH-HHHHHH-----HHHHHHHHHHHHHHHHH---
    spider3: ------E------EEEHHHEEEEEE---EEEE-----------EE---HHHHHHHHHH-HHHHH------HHHHHHHHHHHHHHH-----
 deepconcnf: --------------------EEEEEE--EEEE---------EEEEE--HHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHH---
   disopred: ------------------------------------------------------------------------------DDDDDDDDDDDD
      tmhmm: ------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10888110.95comparative modeling1-909010 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington