SSGCID - MygeA.00711.a L-lactate dehydrogenase MG_460

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10517CompleteStructure predictionssgcidSSGCID - MygeA.00711.a L-...3124 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310  
   sequence: MKGPKIAIVGSGAVGTSFLYAAMTRALGSEYMIIDINEKAKVGNVFDLQDASSSCPNFGKVVAGEYSQLKDYDFIFISAGRPQKQGGETRLQLLEGNVEIMKSIAKEIKKSGFNGVTLIASNPVDIMSYTYLKVTGFEPNKVIGSGTLLDSARLRYAIATKYQMSSKDVQAYVIGEHGDSSVSIISSAKIAGLSLKHFSKASDIEKEFGEIDQFIRRRAYEIIERKGATFYGIGEASADVAEQILKDTKEVRVVAPLLTGQYGAKDMMFGTPCVLSRKGIEKILEIELSNTEKVALENSIKVLKDNIKLAKL
    spider3: ----EEEEE---HHHHHHHHHHHH-----EEEEEE--HHHHHHHHHHHHHHHHH-----EEEE--HHHH----EEEEEE----------HHHHHHHHHHHHHHHHHHHHHH---EEEEEE--HHHHHHHHHHHHH---HHHEE---HHHHHHHHHHHHHHHH---HHHEEEEEE------EEEEEEEEEEE-EEHHHHHH----HHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH-----EEEEEEE---------EEEEE-EEE----EEEEEE----HHHHHHHHHHHHHHHHHHHH---
    psipred: ----EEEEE---HHHHHHHHHHHH-----EEEEEE--HHHHHHHHHHHHH---------EEEE--HHHH----EEEE------------HHHHHHHHHHHHHHHHHHHHHH---EEEEEE--HHHHHHHHHHHHH------EE----HHHHHHHHHHHHHHH-------EEEEE--------------EE--EEHHHHHHH---HHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHH----EEEEEE-----------EEEE--EEE----EEEEE-----HHHHHHHHHHHHHHHHHHHH---
 deepconcnf: ----EEEEE---HHHHHHHHHHHH-----EEEEEE----HHH----------------EEEEE----------EEEE------------HHHHHHHHHHHHHHHHHHHHHH---EEEEEE--HHHHHHHHHHHHH------EEE---HHHHHHHHHHHHHHH------EEEEEEE--------EEEEEEE--EEHHHHHH----HHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH----EEEEE------------EEEEEEEEEE---EEEEEE----HHHHHHHHHHHHHHHHHHHHH--
   disopred: DDD----D---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: ------TTTTTTTTTTTTTTTTTT------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10887110.94comparative modeling1-31231210 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington