SSGCID - MygeA.18996.a 5 -3 exonuclease MG_262

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10513CompleteStructure predictionssgcidSSGCID - MygeA.18996.a 5 ...2914 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290 
   sequence: MKKAILIDGNSLAYRAYFATWKQVEYAKQNNLPFNNAIRTMLLMCWNLIKANVYQYGIVSFDTKAPTFRDQIYEGYKQKRVKTPVELLVQIPLIKQALVYLGFLVCEKDGFEADDLIGSYANLFTKQEITVDIYSSDRDMLQLVNAFTNVFLCIKGTKEMVMYNNENFKSLFYGLAPYQVVEYKGLVGDNSDNLAGIKGIGPIKGIELLQQYGTIDNIYTNFNNLPNQLQKLLNNQKEIAKTFSFLAKIKTDIELDQNIDLTGLKPIQKQALIQLLSENKINTLVEKFSKI
    spider3: --EEEEEEHHHHHHHHHHHHHH-------------HHHHHHHHHHHHHHHHH---EEEEEE------HHHHH-HHH--------HHHHHHHHHHHHHHHHH---EEE-----HHHHHHHHHHHHHH----EEEEE----HHHEE---EEEEE-------EEEE-HHHHHHH-----HHHHHHHHHHH--HHH---------HHHHHHHHHHH--HHHHHH-HHH--HHHHHHHHH-HHHHHHHHHHHHE---------HHHH------HHHHHHHHHH---HHHHHHH---
    psipred: --EEEEE---HHHHHHHH---------------EE-HHHHHHHHHHHHHHHH---EEEEEE----------HHHHH--------HHHHHHHHHHHHHHHH----EEEE----HHHHHHHHHHHHHH---EEEEE-----HHHH----EEEEE--------EEE-HHHHHHHH----HHHHHHHHHH---------------HHHHHHHHHHH--HHHHHHHHHH--HHHHHHHHH-HHHHHHHHHH-EEE--------HHHHH-----HHHHHHHHHH---HHHHHHH---
 deepconcnf: --EEEEEEHHHHHHHHHHHHH-------------HHHHHHHHHHHHHHHHH----EEEEEEE------HHHHHHHHH-------HHHH--HHHHHHHHHH---EEEEE----HHHHHHHHHHHHHH---EEEEEE------------EEEEE-------EEEE-HHHHHHHH-------EE--H-----------------HHHHHHHHHHH--HHHHHH------HHHHHHHHH-HHHHHHHHHHHHHHH-----------------HHHHHHHHHH--HHHHHHHHH--
   disopred: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10883110.95comparative modeling1-29129110 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington