SSGCID - MygeA.20141.a PTS system fructose-specific EIIABC component MG_062

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10512Domain completeStructure predictionssgcidSSGCID - MygeA.20141.a PT...6804 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680
   sequence: MFKNLLRPSLFFNWSQKTFKNKFSFLKQAANALQKQAVINDNNVAFEALKKREEEITTGIITSLALPHLQSQSVIEPFVAVFKVKNLDWQSLDQKPVKLIFLIGVLVDKTNLHLDFISNFSKLMLNETFASKVLNVTSYNGLIKLIDLFNQQKVQDQPAVETKKEYDFVAVTACPTGIAHTFMAKEALEAFAKKHNLYVKVETQGTDGIQNQLTSDDINNAKGVILACDRLIDFSRFYANKNVIEVSTTKAIKKPDEVYELIKNQKGKQLANSAKPTNQTQLAESEGEFNFNNFHKRIYRAILSGVSYMLPFVVFGGILIALSFLIDINNANNAGGNFGTINPVANWLNKLGGISFSLIVPILSAYIAYALVSRQGLLPGFVVGLISSGQFLLNIVLTNGTIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQNYIYKKLPQSLQGIKNILFIPLFGTLFTAGLFWVINIPLIYLNYGLSLFLNIMNSPILAPLLGFVIGLMMCFDLGGPINKAAYVFGVVSLQNQNAGTISMAAAMLSGMVPPLSIALAASIRKSCFDKQELPAAYACYLMGLSFISEGAIPFVVKKPKVMLTANLIAGAICGALTGAFALSIRAPHGGVFVFALLKTTLQGIEGATLQTGVGIGLALVCLIISMIVGSSIIIGYDLIAKHNQRKQNLNS
   disopred: ---------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDD-------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTTTTTTT------------------------TTTTTTTTTTTTTTTTTTTTTTT------TTTTTTTTTTTTTTTTTTTTTTT---------TTTTTTTTTTTTTTTTTTT--------------------TTTTTTTTTTTTTTTTTTTTTTT--------------TTTTTTTTTTTTTTTTTTTTTTT-------------------TTTTTTTTTTTTTTTTTTTTTTT---------TTTTTTTTTTTTTTTTTTTTTTT------TTTTTTTTTTTTTTTTTTTTTTT-----------------------------TTTTTTTTTTTTTTTTTTTTTTT---------------

Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10882110.52comparative modeling1-27527510 Nov 2019
-210.19comparative modeling272-450179-
-310.03comparative modeling447-680234-
-22n/aab initio272-450179-
-32n/aab initio447-680234-



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington