SSGCID - MygeA.19059.a Probable transcriptional regulatory protein MG332 MG_332

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10511CompleteStructure predictionssgcidSSGCID - MygeA.19059.a Pr...2394 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .    
   sequence: MPRKHLIANQTNKKQQTSAKQLQKLAKRIASAVKKGGTNIQSNPHLKVAVDLALAKGLSMDSIKRNIHGSEKDTTKISEFCYEIFGPNGVGIIVFGLTDNPNRLLSSLNGYLAKLKGQLAKPNSVKINFQEEGIIFVNKNNYLKDDLIELLILDNINLIDVDYDEECFEISLHSNSYFHAKELLKKNNFSIVDSEIKLVPLLTVDLDRNQQTLLSRFLNACEEDDDIQFVVHNANPWEE
 deepconcnf: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHHHHHH---------EEEEEEEE---HHHHHHHHH-------HHHHHHHHHH---------EEEEEE---EEEEEE-----HHHHHHHHHHHH----EEEEE--EEEEEE----HHHHHHHHHH----EEEEEEEEEE-------HHHHHHHHHHHHHHH---HHHHHHHH------
    psipred: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHH----HHHHHHHHH--------EEEEEEEEE----EEEEEEE--------HHHHHHHH-----------EEEEEE---EEEEE------HHHHHHHHHHH------------EEEEEE-HHHHHHHHHHHHH-----EEEEEEE----EEE--HHHHHHHHHHHHHHHHH--HHHHH--------
    spider3: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHH-HHHHHHHHHHHH----HHHHHHHHHH--------EEEEEE------EEEEEEE--------HHHHHHHHHH---------HHHHHH--EEEEEE------HHHHHHHHHH--------------EEEEE-HHHHHHHHHHHHH----EEEEEEEEE---EEE--HHHHHHHHHHHHHHHH---HHHEE--------
   disopred: D---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10881110.75comparative modeling1-23923910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington