SSGCID - MygeA.19977.a Probable ABC transporter permease protein MG189 MG_189

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10510CompleteStructure predictionssgcidSSGCID - MygeA.19977.a Pr...3184 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .   
   sequence: MFKNNLRFTSWINQHKFYQLDLSLKTRSIKQIVLTLVFKTLVLGFFGLIVIFPFYLMVVVSFASDERALDTRTPILWPDSWNFDNFSRVLSDGKYLNAIVVNTLVTVLSVLLTLFFTICMGYSFSLRKWKYKKLVWFFFLSVLILPESALLIGQYRIVIVANWNNPNSPLIVLGLIMPFVSSVFSGFMYRTSFEAIPSQLKESALIDGCNGFNYFLKIALPMVKSTSWTVGILTAFSAWNSYLWPLLLLGNRVDLNINLWVLQQGILDANSSDEQIRTLLNLKMSAAILAILPMFIIYFLFHKRIMNAIKNRANTIKG
 deepconcnf: -----HHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHH---------------HHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHH---HHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH-----HHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------
    spider3: -----HHHHHHHHH---------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHH-------------HHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH-HHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------H----HHHHHHHH----HH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------
    psipred: -----HHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHH--------------HHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHH----HHHHHHHHHHHHH--------------EE-----HHHHHHHHHHHHHH--HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--EEEEE--------EEEHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------
   disopred: DDDD------------------DDDDDDDDDDDD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ----------------------------------------TTTTTTTTTTTTTTTTTTTTTTT----------------------------------------TTTTTTTTTTTTTTTTTTTTTTT------TTTTTTTTTTTTTTTTTTTTTTT--------------TTTTTTTTTTTTTTTTTTTT-------------------------------------TTTTTTTTTTTTTTTTTTTTTTT-----------------------------TTTTTTTTTTTTTTTTTTTTTTT-----------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10880110.82comparative modeling1-31831810 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington