SSGCID - MygeA.20002.a Uncharacterized HTH-type transcriptional regulator MG101 MG_101

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10503CompleteStructure predictionssgcidSSGCID - MygeA.20002.a Un...2224 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220  
   sequence: MKFGKEIAKKNQIIYRYIILKIQSFEWPANTRIFSERQLEIRFNSSRSQIRSVLATLLNKNIIRYTKNTPGYFVCKDVGFSFFHKTQDNLKVKYAKLSTLIKKLLSQDDASVFANIDSTVHLDKFKGIEAKFFDENKKHFLNVCFFAKDDILNILDENNLQQQFFREFAYNGIAIEKRHCVTSVDKESGCLVMYDMYYDDNDNFVVASKSNFLNPELKVINA
 deepconcnf: ----HHHHHHHHHHHHHHHHHHH------------HHHHHHHH---HHHHHHHHHHHHH---EEEEE----EEEEE-----HHHHHH-----EEEEEEEEEEE------HHHHHH--------EEEEEEEEEE-----EEEEEEEEEE--------------HHHHHHHH----EEEEEEEEEEEE---EEEEEEEEE-----EEEEEEEEEE--EEEEEE-
    psipred: ------HHHHHHHHHHHHHHHHH------------HHHHHHHH---HHHHHHHHHHHHH---EEE------EEE-------HHHHHHH------EEEEEEEE-------HHHHHHH------EEEEEEEEEEE------EEEEEEEE-HHH------------HHHHHHH-----EEEEEEEEEE---EEEEEEEEEE-----EEEEEEEEE----EEEEE-
    spider3: -----HHHHHHHHHHHHHHHHHH------------HHHHHHHH---HHHHHHHHHHHHH---EEE------EEE-------HHHHHHH-----EEEEEEEEE-------HHHHHHH-------EEEEEEEEEE-----EEEEEEEEEEHHHH----HHHHH--HHHHHHH------EEEEEEEEE----EEEEEEEEE-----EEEEEEEEE---HEEEEE-
   disopred: DDDDDDDDDD------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10864110.93comparative modeling1-22222210 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington