SSGCID - MygeA.20000.a Uncharacterized protein MG296 MG_296

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10501CompleteStructure predictionssgcidSSGCID - MygeA.20000.a Un...1294 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .    
   sequence: MKPQLIAFKKFLQTEFQAVDFETFRINFNLCLKREQDNIVIYEDDDYDDQPFFFKPMLSDGFFIQTEVIKQLDYLAKVVENPKDSDQQCCQNFYEALIVFISALAITKGINPNRFHQRLVNRFAIHAVY
 deepconcnf: -HHHHHHHHHHHHHHH----HHHHHHHHHHHHHH----EEEE-----------------------HHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHH------
    psipred: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---EEEE------HHHHHHHH----HHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH---
    spider3: -HHHHHHHHHHHHHHHH---HHHHHHHHHHHHH------EE---------------HH--HHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH-----
   disopred: DDDDD----------------------------------------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10863110.94comparative modeling1-12912910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington