SSGCID - MygeA.19047.a Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase MG_212

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10499CompleteStructure predictionssgcidSSGCID - MygeA.19047.a Pr...2684 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .   
   sequence: MDKLFKTSFRFIIRFLQILSLPVVFPYFLLSFLACLITSKNYESLPYNYPPEIRFKKVYRLVSMWLYIKGIKVVTVNDKIIPKKPVLVVANHKSNLDPLVLIKAFGRLKNSPPLTFVAKIELKDTVLFKLMKLIDCVFIDRKNIRQIANALETQQQLIRQGTAIAVFAEGTRILSNDIGEFKPGALKVAYNAFVPILPVSIVGSLGKMESNKRLKEHGVKKSSNYEVKVIFNKLINPISFNQIDSNNLANNIRSIISDAYTSEKPSND
    spider3: -----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHH----EEEE---------EEEEE----HHHHHHHHHHH--------EEEEEHHHHH-HHHHHHHHH---EEE----HHHHHHHHHHHHHHHH----EEEE-----------------HHHHHHH----EEEEEEE--HHHHH---HHH---------EEEEEEE----------HHHHHHHHHHHHHHHHHHHHH------
    psipred: -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHH---EEEEEEEE------EEEEE----HHHHHHHHHH---------EEEEEEHHHHH--HHHHHHH---EEEE---HHHHHHHHHHHHHHHH---EEEEE-----------------HHHHHHHH---EEEEEE---HHH-----------------EEEEEEE----------HHHHHHHHHHHHHHHHHHHHHHHH---
 deepconcnf: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHH--EEEEEE--------EEEE------HHHHHHHHHH--------EEEEE-------HHHHHHHH--EEEEE---HHHHHHHHHHHHHHHH---EEEEEE----------------HHHHHHHH---EEEEEEE---------HHHHH--------EEEEEEE----------HHHHHHHHHHHHHHHHHHHH-------
   disopred: DD-----------------------------------------------------------------------------------------------------------------------------------------------DDDD-------------------------------------------------------------------------------------------------------------DDDDDDDDDD
      tmhmm: --------------TTTTTTTTTTTTTTTTTTTTTTT---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10861110.75comparative modeling1-26826810 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington