SSGCID - MygeA.01545.a Ribosomal RNA small subunit methyltransferase H MG_222

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10493CompleteStructure predictionssgcidSSGCID - MygeA.01545.a Ri...3094 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .    
   sequence: MLNNQQIHQSVLINEVIHNLNINPCGNYLDLTAGFAGHSQKILEKLTTGTLTINDVDKESINFCQKLFFKNNNVVIIHDNFANFPVHLKQLSITKFDGILMDLGVSSHQLNQPNRGFSFKNDGPIDMRMDQSNQKNTALTVLKNLTEQKLSLILKKYGDIKHPKPIAIGLKKAVQTEKNLTTTQLAKVVKECATGFEKYQSRNYLAKVFQAIRIYLNDEITNLKTALTFIPNLLKNNSRFLVIVFHSIEEKIVRNFIAKLTSFIQPEALPIKLTPAYQLITKKPILPSQKELELNPRSRSAKLFVIQKN
    spider3: --------EE-HHHHHHHHH------EEEE------HHHHHHHHH----EEEEEE--HHHHHHHHHHHH----EEEE------HHHHHHH-------EEEEE----HHHH---------------------------HHHHHHH--HHHHHHHHHHH-----HHHHHHHHHHHHH------HHHHHHHHHHH--HHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEE--HHHHHHHHHHHHH----------------EEE---------HHHHHH-------EEEEEEE-
 deepconcnf: ----------HHHHHHHHH-------EEEEEE-----HHHHHHHH----EEEEEE--HHHHHHHHHH------EEEEE-----HHHHHHH-------EEEEE-----------------------------------HHHHHH---HHHHHHHHHHH------HHHHHHHHHHHH------HHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-EE-EEEEEEE---HHHHHHHHHHHHH----------------EEEEE-------HHHHHH----HHHHHHHHH--
    psipred: ---------EEHHHHHHHHH------EEEE------HHHHHHHHH----EEEEEE--HHHHHHHHHHH-----EEEE---HHHHHHHHHH-------EEEEE----HHH----------------------------HHHHH----HHHHHHHHHHH--HHHHHHHHHHHHHHH-------HHHHHHHHHHH--HHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----EEEEEE--HHHHHHHHHHHHHH---------------EEEE--------HHHHHH---HHHHHHHHH---
   disopred: DDDDD--D---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D---------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10858110.93comparative modeling1-30930910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington