SSGCID - MygeA.00039.a Methionine aminopeptidase MG_172

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10491CompleteStructure predictionssgcidSSGCID - MygeA.00039.a Me...2484 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .   
   sequence: MIYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQKQAKCAFHGYLGFPGFNCLSLNQTVIHGVADQTVFKDSDKLTLDIGIDYHGYLCDAAFTLLGNKADPKAVKLLNDVEQAFSKVIEPELFVNNPIGNLSNAIQTYFENKGYFLVKEFGGHGCGIKIHEDPLILNWGEKNQGVRLQEGMVICIEPMVMTDSSEITMAANNWNVLTLKSKFNCHVEQMYHITNNGFECLTN
 deepconcnf: -EEE--HHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH---E-------------EEE----EEE------------EEEEEEEEEE------EEEEEEE----HHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHH---EEEE---------------------------------EEEE---EE-----EEE----EEEEE----EEEEE-EEEEEE--EEEEE--
    psipred: -EEE--HHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH---EE-----------EEE----EEE-------------EEEEEE-EEE------EEEEEE-----HHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH---EEEEE--------------------------------EEEEE---------EEEE----EEE------------EEEE-----EE---
    spider3: --E---HHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH---EE----------HEEEE----EE-------------EEEEEEEEEE--EEEEEEEEEE-----HHHHHHHHHHHHHHHHHHHHH-----EHHHHHHHHHHHHHH----HHHHH-------------------------E-----EEEEE--E------EEE-----EEEE----EEEEEEEEEEEE----EEE--
   disopred: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10855110.99comparative modeling1-24824810 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington