SSGCID - MygeA.18842.a 50S ribosomal protein L20 MG_198

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10488CompleteStructure predictionssgcidSSGCID - MygeA.18842.a 50...1244 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    
   sequence: MRVKGTNTTRIRRKKWLKQASGSFGTRKASFKAAKQTVIQASKYAYRDRRQKKREFRSLWILRLNAALRAQGMTYSVFINELKKAKIVINRKVLSELAIKEPNKLNLIINTIKKPTNKPTVAKT
 deepconcnf: ------HHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHH-HHHHHHHHHHHHHH---------
    psipred: ------HHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHH-HHHHHHHHHHHHHHH--------
    spider3: ------HHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHH-HHHHHHHHHHHHHH---------
   disopred: -------------------------------------------------------------------------------------------------------------------DDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10844110.94comparative modeling1-12412410 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington