SSGCID - MygeA.20188.a Uncharacterized protein MG233 MG_233

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10484CompleteStructure predictionssgcidSSGCID - MygeA.20188.a Un...994 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .    
   sequence: MIKINISQNFLVAKGHALFAEKGKDIVCAAISGIIFGGVAWFEPDKIEFTENKLVPSIALKLIDPTPNVAVAFSVITVQLKAIANSYPNHIVINEESYE
    spider3: -EEEEEEEEEEEEEE--------HHHHHHHHHHHHHHHHHHHHHH-----EE----EEEEEE----HHHHHHHHHHHHHHHHHHHH----EEEEEEE--
 deepconcnf: -EEEEEEEEEEEEE----------HHHHHHHHHHHHHHHHHH-------EEEE---EEEEEE----HHHHHHHHHHHHHHHHHHHH----EEEEEEE--
    psipred: -EEEEEEEEEEEEEE----------EEEEHHHHHHHHHHHHHHHHH----------EEEEEE----HHHHHHHHHHHHHHHHHHHH----EEEEEEEE-
   disopred: --------------------------------------------------------------------------------------------------D
      tmhmm: ---------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10840110.95comparative modeling1-999910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington