SSGCID - MygeA.17980.a 30S ribosomal protein S15 MG_424

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10482CompleteStructure predictionssgcidSSGCID - MygeA.17980.a 30...864 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    . 
   sequence: MKIDKEQIIKAHQLHKNDVGSVQVQISILTDQIKKLTDHLLANKKDFISKRGLYTKVSKRKRLLKYLKERNIETYRDLIKNLNLRG
    spider3: -HHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHH---HHHHHHHHHH-----
    psipred: -HHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHH----
 deepconcnf: -HHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHH-----
   disopred: DD-----------------------------------------------------------------------------------D
      tmhmm: --------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10839110.99comparative modeling1-868610 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington