SSGCID - MygeA.17931.a 50S ribosomal protein L19 MG_444

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10481CompleteStructure predictionssgcidSSGCID - MygeA.17931.a 50...1194 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .    
   sequence: MKKINKQALIDAVEQKQLKEYVPEFGAGDEVNVAIKLREKEKVRVQNFTGTVLRRRGRGISETFMVRKTTDGIPIEKNFQIHNPNIDIEVKRRGKVRRAYISYMRERSGKSAKIKEKKS
 deepconcnf: -----HHHHHHHHHHHHHH----------EEEEEEEEE---EEEEEEEEEEEEEEE---EEEEEEEEEEE--EEEEEEEE-----EEEEEEE--EEEEEEEEEEE------HHHH----
    psipred: --HHHHHHHHHHHHHHHHH----------EEEEEEEEEE---EEEEEEEEEEEEE--------EEEEEE-----EEEE-------EEEEEEE-----HHHHHHHH-----HHEEEE---
    spider3: -------HHHHHHHHHHHH----------EEEEEEEEEE---EEEEEEEEEEEEE-------EEEEEEEE---EEEEEE------EEEEEEE---EEEEEEEEE--------E------
   disopred: DDDDDDDDDDD---------------------------------------------------------------------------------------------------------DDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10838110.52comparative modeling1-11911910 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington