2018-04-21_00000020_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
101CompleteStructure predictionrobetta_beta2018-04-21_00000020_1_1919621 Apr 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    . 
   sequence: GSPELRQEHQQLAQEFQQLLQEIQQLGRELLKGELQGIKQLREASEKARNPEKKSVLQKILEDEEKHIELLETLQQTGQEAQQLLQELQQTGQELWQLGGSGGPELRQKHQQLAQKIQQLLQKHQQLGAKILEDEEKHIELLETILGGSGGDELRELLKGELQGIKQYRELQQLGQKAQQLVQKLQQTGQKLWQLG
 deepconcnf: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---
    psipred: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---
    spider3: --HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
   disopred: DDDDDDDDDDDDDDD---------------------DDDDDDDDDDDDDDDDDDDDDDD---------------DDDDDDDDDDDDDDD-------DDDDDDDDDDDDDDDDDDDDDDDDDDDD----------------------------------------------DDDDDDDDDDDDDDDD---------D
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
156110.25comparative modeling1-19619621 Apr 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington