2019-01-12_00000003_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
1096CompleteStructure predictioncameo2019-01-12_00000003_1_1119512 Jan 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
   sequence: MERLDIFGVPIDRVTMIQAVDILNNFLQENRLHIVATPNAEIVMMAQKDKEYMEILNNTDLNVPDGSGIVFASKVFKKPLPERVAGFDLMLEFIKGISSKGVKIYLLGAAAQVAEQARANLEKLYPGVKIVGTHHGYFTEEEENKIIEEINNKGAEVLFVALGAPKQEKWIYKNKDKLKVKIAMGVGGSFDVIAG
 deepconcnf: ---EEE--EEE----HHHHHHHHHHHHH----EEEE---HHHHHHHHH-HHHHHHHH---EEEE--HHHHHHHHHH---------HHHHHHHHHHHHHH---EEEEE---HHHHHHHHHHHHHH----EEEEEE-----HHHHHHHHHHHHH----EEEEE----HHHHHHHH--------EEEEE---HHHH--
    psipred: --EEEEE--EE----HHHHHHHHHHHHH----EEEEE--HHHHHHH---HHHHHHHHH-------HHHHHHHHHH----------HHHHHHHHHHHHHHH---EEEE---HHHHHHHHHHHHHH----EEEEE-------HHHHHHHHHHHHH---EEEEE----HHHHHHHHHHHH----EEEE----EEEE--
    spider3: --EEEE--EEE----HHHHHHHHHHHHH----EEEEE--HHHHHHHHH-HHHHHHHH---EEE---HHHHHHHHH----------HHHHHHHHHHHHHH---EEEEE---HHHHHHHHHHHHHH----EEEEEE-----HHHHHHHHHHHHHH---EEEEE---HHHHHHHHHHHHH----EEEEEEEEEEEE--
   disopred: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
1200110.98comparative modeling1-19519512 Jan 2019
1201120.87ab initio1-19519512 Jan 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington