User input for job 8310

Sequence

MNFPRASRLMQAAVLGGLVMAAAAATAQTVQAADNPYERGPDPTESSIEASRGSFAVSQTSVSSLAVTGFGGGTIYYPTSTAQGTFGAVAISPGFTAYQSSIAWLGPRLASQGFVVFTIDTNTTLDQPDSRGRQLLAALDYLTQRSSVRGRIDSSRLAVAGHSMGGGGSLEAAAARPSLQAAVPLAPWNLDKTWSEVRVPTLIIGGESDSVAPVSSHSVPFYNSIPASAEKAYLELNGASHFFPQTVNTPTARQMVAWLKRFVDDDTRYEQFLCPGPSGSAIEEYRNTCPSA

Forced secondary structure in fragment libraries

# PSIPRED VFORMAT (PSIPRED V4.0)

   1 M C  0.999  0.000  0.001
   2 N C  0.959  0.035  0.006
   3 F C  0.843  0.150  0.008
   4 P C  0.627  0.361  0.011
   5 R H  0.398  0.598  0.004
   6 A H  0.216  0.781  0.003
   7 S H  0.101  0.895  0.004
   8 R H  0.026  0.971  0.003
   9 L H  0.009  0.990  0.001
  10 M H  0.005  0.994  0.001
  11 Q H  0.003  0.997  0.000
  12 A H  0.003  0.997  0.000
  13 A H  0.003  0.997  0.000
  14 V H  0.003  0.997  0.000
  15 L H  0.003  0.997  0.000
  16 G H  0.003  0.997  0.000
  17 G H  0.003  0.997  0.000
  18 L H  0.003  0.997  0.000
  19 V H  0.003  0.997  0.000
  20 M H  0.003  0.997  0.000
  21 A H  0.003  0.997  0.000
  22 A H  0.003  0.997  0.000
  23 A H  0.004  0.996  0.000
  24 A H  0.007  0.992  0.001
  25 A H  0.016  0.983  0.001
  26 T H  0.034  0.964  0.002
  27 A H  0.050  0.947  0.003
  28 Q H  0.099  0.897  0.004
  29 T H  0.145  0.851  0.004
  30 V H  0.092  0.904  0.004
  31 Q H  0.106  0.889  0.005
  32 A H  0.188  0.808  0.005
  33 A C  0.716  0.282  0.002
  34 D C  0.906  0.091  0.003
  35 N C  0.989  0.009  0.002
  36 P C  0.857  0.137  0.006
  37 Y C  0.787  0.197  0.016
  38 E C  0.785  0.201  0.015
  39 R C  0.943  0.047  0.010
  40 G C  0.989  0.006  0.005
  41 P C  0.991  0.005  0.004
  42 D C  0.991  0.005  0.004
  43 P C  0.987  0.008  0.005
  44 T C  0.956  0.030  0.014
  45 E H  0.396  0.593  0.011
  46 S H  0.314  0.663  0.023
  47 S H  0.137  0.844  0.019
  48 I H  0.328  0.643  0.029
  49 E H  0.400  0.569  0.031
  50 A H  0.364  0.607  0.028
  51 S H  0.392  0.589  0.018
  52 R C  0.759  0.220  0.020
  53 G C  0.937  0.036  0.027
  54 S C  0.860  0.056  0.084
  55 F C  0.762  0.034  0.204
  56 A C  0.703  0.018  0.279
  57 V E  0.411  0.010  0.579
  58 S E  0.138  0.011  0.850
  59 Q E  0.048  0.003  0.949
  60 T E  0.029  0.001  0.970
  61 S E  0.026  0.001  0.973
  62 V E  0.055  0.004  0.941
  63 S E  0.351  0.011  0.637
  64 S C  0.715  0.116  0.169
  65 L C  0.657  0.170  0.173
  66 A C  0.548  0.142  0.309
  67 V C  0.664  0.039  0.297
  68 T C  0.828  0.018  0.154
  69 G C  0.887  0.011  0.103
  70 F C  0.801  0.017  0.182
  71 G C  0.864  0.012  0.124
  72 G C  0.804  0.007  0.189
  73 G E  0.105  0.003  0.892
  74 T E  0.025  0.001  0.974
  75 I E  0.019  0.001  0.980
  76 Y E  0.017  0.001  0.982
  77 Y E  0.058  0.003  0.939
  78 P E  0.267  0.010  0.723
  79 T C  0.896  0.011  0.093
  80 S C  0.928  0.028  0.044
  81 T C  0.905  0.070  0.025
  82 A C  0.898  0.091  0.011
  83 Q C  0.966  0.026  0.008
  84 G C  0.969  0.015  0.016
  85 T C  0.939  0.008  0.053
  86 F E  0.461  0.010  0.529
  87 G E  0.108  0.008  0.884
  88 A E  0.035  0.002  0.963
  89 V E  0.016  0.001  0.983
  90 A E  0.013  0.000  0.987
  91 I E  0.023  0.002  0.975
  92 S E  0.123  0.005  0.872
  93 P C  0.983  0.003  0.014
  94 G C  0.988  0.006  0.006
  95 F C  0.980  0.014  0.006
  96 T C  0.983  0.009  0.008
  97 A C  0.983  0.011  0.006
  98 Y C  0.983  0.013  0.004
  99 Q H  0.066  0.933  0.001
 100 S H  0.053  0.944  0.003
 101 S H  0.027  0.971  0.002
 102 I H  0.062  0.936  0.002
 103 A H  0.083  0.914  0.003
 104 W H  0.140  0.857  0.003
 105 L H  0.042  0.955  0.003
 106 G H  0.008  0.991  0.001
 107 P H  0.005  0.994  0.001
 108 R H  0.006  0.993  0.001
 109 L H  0.014  0.985  0.001
 110 A H  0.028  0.968  0.004
 111 S H  0.185  0.809  0.006
 112 Q C  0.963  0.035  0.002
 113 G C  0.977  0.004  0.019
 114 F C  0.645  0.004  0.351
 115 V E  0.042  0.003  0.955
 116 V E  0.016  0.001  0.983
 117 F E  0.013  0.000  0.987
 118 T E  0.016  0.001  0.983
 119 I E  0.189  0.011  0.800
 120 D C  0.948  0.007  0.045
 121 T C  0.982  0.007  0.011
 122 N C  0.988  0.008  0.004
 123 T C  0.981  0.012  0.007
 124 T C  0.970  0.020  0.010
 125 L C  0.956  0.032  0.012
 126 D C  0.962  0.027  0.011
 127 Q C  0.982  0.010  0.008
 128 P C  0.823  0.168  0.009
 129 D C  0.791  0.201  0.009
 130 S C  0.611  0.381  0.008
 131 R C  0.572  0.422  0.006
 132 G H  0.224  0.770  0.006
 133 R H  0.077  0.918  0.005
 134 Q H  0.031  0.966  0.003
 135 L H  0.008  0.991  0.001
 136 L H  0.004  0.995  0.001
 137 A H  0.003  0.997  0.000
 138 A H  0.004  0.996  0.000
 139 L H  0.007  0.992  0.001
 140 D H  0.016  0.983  0.001
 141 Y H  0.032  0.966  0.002
 142 L H  0.050  0.946  0.004
 143 T H  0.175  0.821  0.004
 144 Q H  0.202  0.792  0.006
 145 R C  0.518  0.478  0.004
 146 S H  0.141  0.854  0.005
 147 S H  0.050  0.944  0.007
 148 V H  0.100  0.888  0.012
 149 R H  0.286  0.709  0.005
 150 G H  0.457  0.538  0.006
 151 R C  0.852  0.132  0.015
 152 I C  0.827  0.058  0.115
 153 D C  0.787  0.022  0.191
 154 S C  0.726  0.182  0.092
 155 S C  0.859  0.096  0.045
 156 R C  0.856  0.053  0.091
 157 L E  0.086  0.002  0.912
 158 A E  0.023  0.001  0.976
 159 V E  0.015  0.000  0.985
 160 A E  0.012  0.000  0.988
 161 G E  0.012  0.000  0.988
 162 H E  0.050  0.002  0.948
 163 S C  0.975  0.007  0.018
 164 M H  0.063  0.936  0.001
 165 G H  0.046  0.953  0.001
 166 G H  0.019  0.980  0.001
 167 G H  0.004  0.995  0.001
 168 G H  0.002  0.998  0.000
 169 S H  0.003  0.997  0.000
 170 L H  0.003  0.997  0.000
 171 E H  0.003  0.997  0.000
 172 A H  0.004  0.996  0.000
 173 A H  0.008  0.991  0.001
 174 A H  0.041  0.957  0.002
 175 A H  0.117  0.880  0.003
 176 R C  0.985  0.015  0.000
 177 P C  0.856  0.138  0.006
 178 S C  0.864  0.120  0.016
 179 L C  0.869  0.069  0.061
 180 Q C  0.792  0.012  0.196
 181 A E  0.057  0.002  0.941
 182 A E  0.021  0.001  0.978
 183 V E  0.025  0.001  0.974
 184 P E  0.096  0.005  0.899
 185 L E  0.216  0.011  0.773
 186 A C  0.892  0.010  0.098
 187 P C  0.956  0.020  0.024
 188 W C  0.913  0.072  0.014
 189 N C  0.914  0.077  0.009
 190 L C  0.920  0.074  0.006
 191 D C  0.969  0.027  0.004
 192 K C  0.868  0.126  0.006
 193 T C  0.812  0.179  0.009
 194 W H  0.361  0.635  0.004
 195 S H  0.363  0.631  0.006
 196 E H  0.429  0.565  0.006
 197 V C  0.939  0.050  0.011
 198 R C  0.957  0.015  0.028
 199 V C  0.931  0.026  0.043
 200 P C  0.920  0.016  0.064
 201 T C  0.471  0.062  0.467
 202 L E  0.130  0.034  0.836
 203 I E  0.077  0.020  0.902
 204 I E  0.145  0.029  0.825
 205 G E  0.461  0.024  0.515
 206 G E  0.400  0.017  0.583
 207 E C  0.723  0.022  0.255
 208 S C  0.880  0.042  0.078
 209 D C  0.898  0.047  0.055
 210 S C  0.789  0.037  0.174
 211 V C  0.773  0.020  0.208
 212 A C  0.783  0.016  0.201
 213 P C  0.890  0.016  0.094
 214 V C  0.524  0.461  0.015
 215 S C  0.539  0.449  0.012
 216 S C  0.306  0.686  0.008
 217 H C  0.516  0.474  0.010
 218 S C  0.691  0.298  0.011
 219 V H  0.165  0.831  0.004
 220 P H  0.400  0.594  0.006
 221 F H  0.167  0.826  0.007
 222 Y H  0.050  0.945  0.005
 223 N H  0.176  0.813  0.011
 224 S H  0.495  0.498  0.008
 225 I C  0.960  0.036  0.004
 226 P C  0.872  0.113  0.015
 227 A C  0.760  0.221  0.020
 228 S C  0.659  0.303  0.038
 229 A C  0.621  0.295  0.084
 230 E C  0.722  0.064  0.213
 231 K E  0.178  0.013  0.809
 232 A E  0.051  0.009  0.940
 233 Y E  0.049  0.007  0.944
 234 L E  0.016  0.001  0.983
 235 E E  0.019  0.003  0.978
 236 L E  0.155  0.016  0.828
 237 N C  0.930  0.015  0.055
 238 G C  0.971  0.011  0.018
 239 A C  0.943  0.020  0.037
 240 S C  0.936  0.022  0.042
 241 H C  0.931  0.025  0.044
 242 F C  0.909  0.021  0.070
 243 F C  0.921  0.015  0.064
 244 P C  0.861  0.022  0.116
 245 Q C  0.900  0.038  0.062
 246 T C  0.914  0.062  0.024
 247 V C  0.970  0.021  0.009
 248 N C  0.989  0.007  0.004
 249 T C  0.680  0.316  0.005
 250 P H  0.140  0.856  0.004
 251 T H  0.061  0.933  0.006
 252 A H  0.025  0.972  0.003
 253 R H  0.007  0.992  0.001
 254 Q H  0.007  0.992  0.001
 255 M H  0.010  0.989  0.001
 256 V H  0.009  0.990  0.001
 257 A H  0.005  0.994  0.001
 258 W H  0.004  0.995  0.001
 259 L H  0.005  0.994  0.001
 260 K H  0.006  0.993  0.001
 261 R H  0.019  0.979  0.002
 262 F H  0.056  0.941  0.003
 263 V H  0.242  0.756  0.002
 264 D C  0.718  0.280  0.002
 265 D C  0.928  0.069  0.003
 266 D C  0.967  0.030  0.003
 267 T H  0.377  0.621  0.002
 268 R H  0.276  0.716  0.008
 269 Y H  0.124  0.870  0.007
 270 E H  0.024  0.968  0.008
 271 Q H  0.060  0.929  0.011
 272 F H  0.090  0.896  0.014
 273 L H  0.316  0.662  0.022
 274 C C  0.958  0.038  0.004
 275 P C  0.988  0.006  0.006
 276 G C  0.989  0.007  0.004
 277 P C  0.983  0.011  0.006
 278 S C  0.974  0.018  0.008
 279 G C  0.928  0.057  0.016
 280 S C  0.925  0.047  0.029
 281 A C  0.695  0.235  0.070
 282 I H  0.256  0.692  0.052
 283 E H  0.243  0.668  0.089
 284 E H  0.213  0.684  0.103
 285 Y C  0.516  0.350  0.134
 286 R C  0.661  0.232  0.107
 287 N C  0.710  0.214  0.075
 288 T C  0.766  0.184  0.050
 289 C C  0.966  0.021  0.013
 290 P C  0.979  0.013  0.008
 291 S C  0.987  0.006  0.007
 292 A C  1.000  0.000  0.000



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington