User input for job 7252

Sequence

VEWSASERSTITSLWGKINVAEIGPQALARVLIVYPWTQRYFGKFGDLSNAAAIQGNAKVAAHGKVVLGALEKAVKNMDDVKGTYSKLSQLHNEKLNVDPDNFRLLGDCLTIVLATKLGAGFPAEIQAVWQKFVAVVVSALSKQYF



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington