User input for job 7244

Sequence

SGLVVMVLANNEDVKSVNDLDGKVVAVKSGTGSVKYAKAYIKTKDLLIFPNIDNAYMELATNRADTVLHDKANILYFIKTAGNGKFKAVYLVQYM



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington