User input for job 4114

Modeling method AB only

Sequence

MDGKTLLLVLLGGGVAAYLAYSLAKRAPASPSSGGGTGDAGQTPPAVVDYGDAGAGLGFGLGNLGQDALCRVAPSLCSWWWNPAPQPAPTLW



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington