User input for job 13881

Sequence

KIAALKYKNAALKKKIAALKQGAPGLEGSGLKPDLPKLVKLLKSSNEEILLKALRALAEIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSH



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington