User input for job 11131

Modeling method CM only

Partial threads

Sequence

MAPVPEDLEARQSGCADVMVVYARGTDQDSPIGDPASVGVLFRDNIKSLLGSRTFSFQGVNYAANVIGFLQGGDPAGSRQMTTDLTNVANSCPNAKIVSAGYSQGGQLVHNSAAQLTAAVRNRINAVVIFGDPKSDQAVTGIPSSNVKIICHDGDNICEGGFIVTSQHTNYQQDAPAAAQFVLSKVGGSGGSGGSGGINMSNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGALEHHHHHH



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington