T1014 Domain 2 Parse 1 Confidence: 0.42

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
539CompleteStructure predictioncaspT101427627 Jul 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
781210.42comparative modeling150-27612727 Jul 2018
                  .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    . 
   sequence: APFATAAAPLRAAPLEGRNVAIASPNAIVRAATARQIEAAGGRAYAAVDIASALAGAPADAVLLIDAALSGPRGALKPPAGRRSVVLLTPEQRDRIDRLKAAGFSGYLIKPLRAASLVAQVLQAVTA
 deepconcnf: ------------------EEEEE---HHHHHHHHHHHHH---EEEEE--HHHHHH-----EEEEEE-----------------EEEEE----HHHHHHHHH----EEEE----HHHHHHHHHHHH--
    psipred: ------------------EEEEE---HHHHHHHHHHHHH---EEEEE--HHHHHH------EEEE--------HHHH-------EEEEE---HHHHHHHHH----EEEE----HHHHHHHHHHHH--
    spider3: ------------------EEEEEE--HHHHHHHHHHHHH---EEEEE--HHHHHHH-----EEEEE-------HHH--------EEEEE---HHHHHHHHH----EEEE----HHHHHHHHHHHH--
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington