2018-05-26_00000101_1_19 Domain 1 Parse 1 Confidence: 0.10

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
271CompleteStructure predictionrobetta_beta2018-05-26_00000101_1_1913026 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
411110.10comparative modeling1-13013027 May 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
   sequence: AHMQEAANRSPPYAPYPYPVDEIIGGDSVQSIQRRLLGTNWNPSAHDMQMSRIQAEDLFELKVEIIRKMAGLHPSGDWMGWGARALDNPRTATGEEDLARLHQMLDDLQSRNEQSATFWRLVERVRLRAD
 deepconcnf: ----------------------------HHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHH------------------------HHHHHHHHHHHHHHHH-----HHHHHHHHHHHH---
    psipred: ----------------------------HHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHH----------HHHHHHHHHHHHH-----HHHHHHHHHHH----
    spider3: ----------------------------HHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHH-------HHHHHHHHHHHHHHHH-----HHHHHHHHHH-----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington