2018-05-20_00000064_1_19 Domain 1 Parse 1 Confidence: 0.90

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
231CompleteStructure predictionrobetta_beta2018-05-20_00000064_1_1935920 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
353110.90comparative modeling1-35935920 May 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .    
   sequence: MAGMKTSPSQDEEACVLAIQLATSTVLPMILKSAIELDILNTISKAGPGNYLSPSDLASKLLMSNPHAPIMLERILRVLATYKVLGCKPSELSDGEVEWLYCWTPVCKFLSNNEDGASIAPLLLVHQDQVPMKSWYHLTDAILDGGTAFNKAYGMNIFDYASQDPQFNKVFNRSMAGHSTITMKKILETYNGFEGLKSIVDVGGGSGATLNMIISKYPTIKGINFDLPHVVGDSPIHPGVEHVGGDMFASVPKGDAIFLKWIFHSWSDEDCLRILKNCYEALADNKKVIVAEFIIPEVPGGSDDATKSVVHLDAVMLAYVPGGKERTEKEFEALATSAGFKSFRKVCCAFNTWIMEFSK
 deepconcnf: ---------HHHHHHHHHHHHHHH-HHHHHHHHHHH--HHHHHHHH-------HHHHHHHH-------HHHHHHHHHHHHH----EE------------EEE-HHHHHHH--------HHHHHHH-------H-HHHHHHHHHH---HHHHHH---HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH--------EEEEE----HHHHHHHHHH-----EEEE---HHH---------EEEE--------HHHHHHHHHHHH---HHHHHHHHHHHHHHH----EEEEEE-------------HHHHHHHHHHHHH---------HHHHHHHHHH----EEEEEE----EEEEEEE-
    psipred: -----------HHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHH--------HHHHHHH--------HHHHHHHHHHHH----EEEE-----------EEE--HHHHHH--------HHHHHHHH--HHHHHHHHHHHHHHHH---HHHHHH---HHHH----HHHHHHHHHHHHHHHHHHHHHHHHH--------EEEEE---HHHHHHHHHHH-----EEEE--HHHH---------EEE----------HHHHHHHHHHH---HHHHHHHHHHHHHH-----EEEEEEEEE-------HHHHHHHHHHHHHHH----------HHHHHHHHHH-----EEEEE----EEEEEEE-
    spider3: ---------HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH--------HHHHHHHH-------HHHHHHHHHHHHH---EEEE-----------EEE--HHHHHH--------HHHHHHHH--HHHHHHHH-HHHHHHH---HHHHH----HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH--------EEEEE-----HHHHHHHHH-----EEEE--HHHHH-------EEEE------------EEEEEH------HHHHHHHHHHHHHH-----EEEEEEEE----------HHHHHHHHHHHHHH---------HHHHHHHHHH-----EEEEE-----EEEEEE-
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington