T0949 Domain 1 Parse 1 Confidence: 0.64

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
137CompleteStructure predictioncaspT09491831 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
204110.64comparative modeling33-1831511 May 2018
               .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180   
   sequence: LPNPSGQVINGVHHYTIDEFNYYYKPDRMTWHVGEKVELTIDNRSQSAPPIAHQFSIGRTLVSRDNGFPKSQAIAVGWKDNFFDGVPITSGGQTGPVPAFSVSLNGGQKYTFSFVVPNKPGKWEYGCFLQTGQHFMNGMHGILDILPAQGS
 deepconcnf: ------------EEEEEEE--EEEE--EEEE----EEEEEEEE---------EEEEEEE----------HHHHHHHHHHH-------EE----------EEEEE----EEEEEEE-----EEEEEEEEEE-HHHHH---EEEEEEEE----
    psipred: ------------EEEEEEE---EEE--EEEE----EEEEEEEE----------EEEEE--HHHHHHHHHHHHHHHHHHHH--------------------EEEE----EEEEEEEE-----EEEEEE----HHHHH---EEEEEEEE----
    spider3: ------------EEEEEEE---EEE--EEEE----EEEEEEEE----------EEEEEE-----------HHHHHHHHHHHH-----EE----------EEEEE----EEEEEEE-----EEEEEEE-----HHHH---EEEEEEEE----
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington