2018-04-28_00000085_1_19 Domain 1 Parse 2 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
136CompleteStructure predictionrobetta_beta2018-04-28_00000085_1_1958828 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
20112n/aab initio1-10510529 Apr 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
   sequence: MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGI
 deepconcnf: -----------------------EEE-----------------------------------------------EEEEEE--EEEEEE------------------
    psipred: ----EEEE---------------EEE------------------------------------------------EE------EEEEEEEE---------------
    spider3: ---------------------------------HH---------------------------------E-----EEE----EEEEEEEEE---------------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington