2018-04-28_00000085_1_19 Domain 3 Parse 1 Confidence: 0.72

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
136CompleteStructure predictionrobetta_beta2018-04-28_00000085_1_1958828 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
200310.72comparative modeling163-58842629 Apr 2018
               .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .   
   sequence: INYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
 deepconcnf: ------EEE-------------------------EEE---------EEEEEEEEE---EEEEEEEE-----EEEEEEE---HHHHHHHHHHHHHHHHHH------------HHH-EEE--EEEEEE------HHHHHHH-------HHHHHHHHHHHHHHHHHHHH------------EEEEE----EEEEEE-------------EEE-----HHHHHH-------HHHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHH--HHHHHHHHH-------EEEE----EEEE------------------HHHH-----HHHHHHHHHHHH---------HHHHH----HH-----------------------------------HHHHHHHHHHHH------------------
    psipred: ------EEE-------------------------EEE----EE---EEEEEEEEE---EEEEEEEE-----EEEEEEEE---HHHHHHHHHHHHHHHHH---------EEEEEEEEEE--EEEEEE------HHHHHHH-------HHHHHHHHHHHHHHHHHHHH--EE-----HHHEEE-------EEE------EE--------EE------HHHH-------HHHHHHHHHHHHHHHH---------HHHHHHHHHHH-----HHHHHHHHHHHHHHHH--------------HHH----HHHHHHH---------HHHH------HHHHHHHHHH-----HH---HHHHH--HHHHH-------------------------HHHHH--HHHHHHHHHHHHHHHHHHH----HHH------
    spider3: ------EEE-------------------------EE----------EEEEEEEEE----EEEEEEE-----EEEEEEE---HHHHHHHHHHHHHHHHHH---------EEEEEEEEEE--EEEEEEE-----HHHHHHH-------HHHHHHHHHHHHHHHHHHHH--EEE----HHHEEEE----EEEEEE-----E---------EEEH---HHHHHH--------EHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHHHHHHHHHHHHH---------E------EEE------------------HHHH------HHHHHHHHH-----HHH---HHHHH--HHHH----------------------HHH------------HHHHHHHHHHHHH---------------
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington