2018-04-28_00000085_1_19 Domain 2 Parse 1 Confidence: 0.25

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
136CompleteStructure predictionrobetta_beta2018-04-28_00000085_1_1958828 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
199210.25comparative modeling101-1676729 Apr 2018
                 .  110    .  120    .  130    .  140    .  150    .  160    .  
   sequence: QSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPE
 deepconcnf: ------------------------------------------HHHHHHH------HHHHHHHH----
    psipred: ------------------------------------------HHHHHHHHHHH--HHHHHHHH----
    spider3: ------------------------------------------HHHHHHHHH----HHHHHHHH----
| | View
Powered by 3Dmol.js.
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington