2018-04-28_00000081_1_19 Domain 1 Parse 1 Confidence: 0.56

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
133CompleteStructure predictionrobetta_beta2018-04-28_00000081_1_1921028 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
187110.56comparative modeling1-20420428 Apr 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    
   sequence: DAAQPARRARRTYEAYPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIIK
 deepconcnf: ------EEEEEEE-------------EE----EEE-------------EEEEEEE-----E-------------EEE-------E-------------EEE-------EE------------EEE---------------------EEEE-----------HHHHHHHH-----------------------------------
    psipred: -HHHHHHHHHHHHH-----------------EEEE---------------EEE-------EE-HHHH-------EEE-------EE-HHH--------EEE-------EE-HHHH-------EEE-------EE-HHHHH------EEEE----------HHHHHHHHHH-------------HHH----HHH--HHH------
    spider3: --HHHHHHHHHHH-------------EEE--EEEEE--------------EEE-------EE------------EEE-------EE------------EEE-------EE------------EEE---------------------EEE---------HHHHHHHHHHH---------E----HHH---EHHH--HHHEE----
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington