2018-04-28_00000055_1_19 Domain 1 Parse 1 Confidence: 0.97

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
124CompleteStructure predictionrobetta_beta2018-04-28_00000055_1_1928028 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
183110.97comparative modeling1-28028028 Apr 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
   sequence: VHPITYYPVDTQRLVRSNAERIRHKPYAHYFNPDVAVPEEVFAALKAPLEPEQVLGTSSTELNRLLEPGYLEGETGYCGLPDGAGYTSSLVRFPGATPEMFRWWFWWHSFEPERYSLWHPWCHADIWRTDPETETAPNLTDEQRYVGSTHHINEYIGQDPLDIEITFIDPARWGFDADGFAAAGIGAHACGSVLMKGSHMRLATMVHLARITDDGFELRSRYWIADRAEPRHDPVAGIAQLTTVPGFSGERQAYEQLVHDQTEFNHLATFLPDIYQEFGP
 deepconcnf: -----------------HHHHH----------------HHHHHHHH-----HH----------------------EEEE-----EEEEEEE------HHHHHHHHHH--------EE------EEEEE---------------------EEEEEEE----EEEEEEEE--------HHHHHH---EEEEEEEEE------EEEEEEEEEEE---EEEEEEEEEEE-----------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
    psipred: -------------------HHHH---HHHH--------HHHHHHHH------------HHHHHHHH----------EEE-----EEEEEEEE-----HHHHHHH----------EEEE--HHH-EEEE---------------EE----EEEEE--------EEEEE--HHH----HHHH-----EEEEEEEE---------EEEEEEEEE---EEEEEEEEEE--------HHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
    spider3: ------------------HHHH----HHHH--------HHHHHHH-----HHHHH---HHHHHHH----------EEEE-----EEEEEEEE-----HHHHHHHHHHH----HHHHH--HHHEEEEEE------------HHHH----EEEEEEEE------EEEEE--HHHH---HHHHHH----EEEEEEEEE-----EEEEEEEEEEE---EEEEEEEEEE----------HHHHHH---------HHHHHHHHHHHHHHHH-HHHHHHHHHHHH--
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington