2018-04-28_00000004_1_19 Domain 1 Parse 1 Confidence: 0.73

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
120CompleteStructure predictionrobetta_beta2018-04-28_00000004_1_1924828 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
177110.73comparative modeling1-24224228 Apr 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240  
   sequence: MATTTTLLSASHKAAYDLRSDGITTDGRSTVLLVSVGADYHEGEKLAATIDLINRSNFGRVSIAVADTLQRHNLSGGTDIDRHARARIAGDEWIARNSTLLDRIDCPTNVLRWDFALSHPRYGDLYDAVEHAYETDEPYRHAIDSTIDRFIERRLSREPDVDQESVRKACRAYLLEECPIIMPLWAHEGFDFVIYPQRISAAMGRTRELFVVPEHPDRVAWLPLRFKKRKSALHGAREEQRS
 deepconcnf: ------------EE--------EEE---EEEEEEE-------HHHHHHHHHHHHH-----EEEEEE-HHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHH-----EEEEEHHHHHH-HHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHH--EEEE-----HHHHHHHHHHHH--------EEEEEEE----------------
    psipred: ----------EEEE--------------EEEEEE--------HHHHHHHHHHHHH-----EEEEE--HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEHHHHH--HHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHH--HHH----EEEE----HHHHHHHHHHHH---------EEEEEE----------------
    spider3: ----------EEEEE-------EEE---EEEEEE--------HHHHHHHHHHHH-----EEEEEEE-HHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEHHHHH--HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHH----EEE------HHHHHHHHHH----------EEEEEE----------------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington