hsUbiquilin-1 Domain 3 Parse 2 Confidence: 0.43

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11134ExpiredStructure predictionsaladihsUbiquilin-158914 Nov 201918 Dec 2019
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
11255320.43ab initio362-48712616 Nov 2019
                .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  
   sequence: NLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPG
    psipred: -------------HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH----------HHHHHHHH--HHHHHHH-HHHHHHH--HHHHHHHHHHHHHHHHHHHH-----------
    spider3: --------------HHHHHHHHH---HHHHHHHH--HHHHHHHHHHHH-HHHHHHHHH--HHH---HHHHHHHHHHHHHHHHHH--HHHHHHH--HHHHHHHHHHHHHHHHHHHH-----------
 deepconcnf: -------------HHHHHHHHHHHH-HHHHHHHH--HHHHHHHHHHHH-HHHHHHHHH--------HHHHHHHHHHHHHHHHHH--HHHHHH---HHHHHHHHHHHHHHHHHHHH-----------
| | View
Powered by 3Dmol.js.
| | Alignment




http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington