SSGCID - MygeA.00015.a 30S ribosomal protein S10 MG_150 Domain 1 Parse 1 Confidence: 0.92

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10500CompleteStructure predictionssgcidSSGCID - MygeA.00015.a 30...1064 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10862110.92comparative modeling1-10610610 Nov 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    . 
   sequence: MNSAVKYPELKIKLESYDSTLLDLTIKKIVEVVKGVNIKIKGPLPLPTKKEVITIIRSPHVDKASREQFEKNTHKRLMILVDVNQGGIDSLKKIKIPVGVTLRFSK
 deepconcnf: --------EEEEEEEE--HHHHHHHHHHHHHHHHH---EEEEEEE-----EEEEEEE-----HHHHHHHHHHHHHHHHHH----HHHHHHHH--------EEEEE-
    psipred: ---------EEEEEE---HHHHHHHHHHHHHHHHH---EEE-------EEEEEEE---------HHHHHHHHHHHHEEEE----HHHHHHHH---------EEEE-
    spider3: --------EEEEEEEE--HHHHHHHHHHHHHHHHHH---EE--------EEEEEEE--------HHHHHHHHHHHHEEHH----HHHHHHHH---------EEEE-
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington