hsUBAC1 Domain 4 Parse 1 Confidence: 0.42

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10800Domain completeStructure predictionmyfryhsUBAC14059 Nov 201914 Dec 2019
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10852410.42comparative modeling330-4057610 Nov 2019
                  .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
   sequence: KPSPEELDKGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
    spider3: ---HHHHH-------HHHHHHHH---HH-----HHHHHHHHHHHH----HHHHH----HHHHHHHHHHHHHH----
 deepconcnf: ---HHHHH-------HHHHHHHH--HHHH----HHHHHHHHHHHH--------------HHHHHHHHHHHHHH---
    psipred: ---HHHHH-------HHHHHHHH--EEHH----HHHHHHHHHHHH------HH-------HHHHHHHHHHHHH---
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington