2019-11-09_00000165_1_11 Domain 2 Parse 1 Confidence: 0.29

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10841CompleteStructure predictioncameo2019-11-09_00000165_1_1111599 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10833210.29comparative modeling1048-11531069 Nov 2019
                    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150   
   sequence: PNYTVPDLVVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLVDLKWLNRVETYIKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLNSENLYFQSGS
 deepconcnf: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH------------EEEEE--EEEEEEEE-----EEE----
    psipred: ------HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------EEE----EEEEHHHH-----EE----
    spider3: -------HHHHHHHHEEE-E--EEE-----------EHHHHHHHHHHH---HHHHHHHHHHHHHH--------------EEEE----EEEEEEE------EE----
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington