2019-11-09_00000114_1_11 Domain 1 Parse 1 Confidence: 0.91

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10825CompleteStructure predictioncameo2019-11-09_00000114_1_111619 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10807110.91comparative modeling1-1611619 Nov 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160 
   sequence: VTRNVEVTAEEEKIRDKLGYEAIRDIHRDMDDDHSGSIDRNESTGFMKEDMQMRGSERTRRENKFHGDDDAITVDDLWEAWFESIERTWTNERLVEWLINDVNLPSIVEAVKAKKIDGKILPRFASPNSDFLNKELGIKSSVYRQKLRLNSLDVVLFGYKD
 deepconcnf: --------HHHHHH--HHHHHHHHHHHHHH-----------HHHHHHHHHH-----HHHHHHHH---------HHHHHHHHHH-------HHHHHHHHHHH---HHHHHHHHHHHH------------HHHHHHHH----HHHHHHHHHHHHHHHHH----
    psipred: -------------------HHHHHHHHHH--------------HHHHH--------HHHHH------------HHHHHHHHHH-------HHHHHHHHHH----HHHHHHHHHH---HHHHHHHHH--HHHHHHHH----HHHHHHHHHHHHHHHH-----
    spider3: --------HHHH-H-----HHHHHHHHHH----------HHHHHHHHHHHH-----HHHHHHHH---------HHHHHHHHH--------HHHHHHHHHHH---HHHHHHHHHH-------HHH----HHHHHHH-----HHHHHHHHHHHHHHHHH----
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington