2019-11-09_00000125_2_11 Domain 1 Parse 1 Confidence: 0.35

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10827CompleteStructure predictioncameo2019-11-09_00000125_2_11349 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10804110.35comparative modeling1-34349 Nov 2019
             1   .   10    .   20    .   30    
   sequence: GLTIEAEPTELSYQDALEMLAESKPVSTTLSFER
    psipred: ------------HHHHHHHHH------EEEE---
    spider3: ------------HHHHHHHHHH------------
 deepconcnf: --EEEE------HHHHHHHHHH----EEEEEEE-
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington