2019-11-09_00000069_1_11 Domain 2 Parse 1 Confidence: 0.90

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10815CompleteStructure predictioncameo2019-11-09_00000069_1_114349 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10796210.90comparative modeling42-4343939 Nov 2019
                .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    
   sequence: SGIEGRMNTTDAKRAPRIAVVGGGLGGLALAGMLHRQGIAATVYERDAGRAARTQGGTLDLRPESGQRALDELGLTEAFRADARPEGEELRILDPAGRTLVHRVPEPGGGSRPEIDRGALRELLLSKVPDEAVSWGRRLTGVEELPDGGHRLEFADGGHADCDILVGADGARSRVRLLLTDARPVHLSAYLQLAITDADRRRPRIAEFVGPGSLMALGDNLNLGAQRSGDGTIRVSVTTRVDADWVDRQGFGDAEWGDVVARLHELFAGWDAGLTSLIDACDPGSLVGRNIEALPVGTRWPSRPDVTLLGDAAHLMPPVGEGANQAMLDGVLLARAFAQHRDDPAAAIAAYETEMFDRAAVIGAKSARIESMGLAPDAAERLASYFNRMTAAS
 deepconcnf: ----------------EEEEE---HHHHHHHHHHHH----EEEEE------------EEEE----HHHHHHH---HHHHHHH------EEEEE-----EEEEE-------------HHHHHHHHHHH-----EEE--EEEEEEE----EEEEEE----EEEEEEEEE------------------EEEEEEEEEEE--------HH------EEEEEE--EEEEEEE-----EEEEEEEEE--------------HHHHHHHHHHHH----HHHHHHHHHH-----E------------------EEEE-------------HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHH----
    psipred: -------HH--------EEEE---HHHHHHHHHHHH-----EEEE-------------------HHHHHHHH---HHHHHHH-------EEEE-----EEEE--------------HHHHHHHHHHH-----EEE--EEEEEEE----EEEEEE----EEEE-EEEE------------------EEEEEEEEE--------HHHHHHH---EEEEE----EEEEEE----EEEEEEEE---HHHHH--------HHHHHHHHHHH-----HHHHHHHHH----------------------------HHHHHHH-------HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH-----
    spider3: -----------------EEEE---HHHHHHHHHHHH----EEEEE-----------------HHHHHHHHHH--HHHHHHHH--HHHHHHEEE-----EEEE--------------HHHHHHHHHH------EE---EEEEEEE-----EEEEE----EEEEEEEEE---------------------EEEEEEE--HHHH-HHHHHHH---EEEEE----EEEEEE-----EEEEEEEE--HHHHHH----HHHHHHHHHHHHHHH----HHHHHHHHH------E---HHH-------------EHHHHHHH------HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH---
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington