2019-11-09_00000069_1_11 Domain 1 Parse 1 Confidence: 0.33

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10815CompleteStructure predictioncameo2019-11-09_00000069_1_114349 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10795110.33comparative modeling8-49429 Nov 2019
              10    .   20    .   30    .   40    .    
   sequence: SSGLVPRGSGMKETAAAKFERQHMDSPDLGTGGGSGIEGRMN
 deepconcnf: ----------HHHHHHHHHHHHH-------------------
    psipred: ----------HHHHHHHHHHHHH-------------------
    spider3: -----------HHHHHHHHHHH--------------------
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington