2019-11-09_00000075_1_11 Domain 2 Parse 2 Confidence: 0.20

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10817CompleteStructure predictioncameo2019-11-09_00000075_1_113769 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10793220.20ab initio282-366859 Nov 2019
                .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    . 
   sequence: REPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHFGGSLEVLFQGPAAYPYDVPDYAAA
 deepconcnf: ---------EEE----EEEE-------------------------------------------EEEEEEE---------------
    psipred: ---------EEE----EEE-----------------EE-------------HHHHHHHHHH--EEEEEEE---------------
    spider3: -----------E-----EE----------------------------------HHHHHHH----EEEEE----------------
| | View
Powered by 3Dmol.js.




http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington