2019-11-09_00000058_1_11 Domain 1 Parse 1 Confidence: 0.60

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10810CompleteStructure predictioncameo2019-11-09_00000058_1_111869 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10781110.60comparative modeling11-1861769 Nov 2019
                 .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    . 
   sequence: SSGLVPRGSHMMATNFFIQPITEEAEAYYPPSVITNKRKDLGVDVYCCSDLVLQPGLNIVRLHIKVACEHMGKKCGFKIMARSSMCTHERLLILANGIGLIDPGYVGELMLKIINLGDTPVQIWAKECLVQLVAQGDHVPDHINILKRNQIFPLFAPTPRGEGRFGSTGEAGIMRT
    psipred: --------------EEEEEE------------------------------EEE----EEEEEE--EEEE--------EE----HHHHH---EEE-------------EEEEEEEE-----EEE----EEEEEEEEEEEEEE-------EEEE------------------------
    spider3: -------------EEEEEEE--HHHHHH--------------EEEEE---EEE-----EEEE---EEEEE---EEEEEEE---HHH-----EEE-----EE------EEEEEEEE-----EEE----EEEEEEEE------EEEEEEEEEE-------------------------
 deepconcnf: --------------EEEEEE--HHHHHH-------------EEEEEE---EEE-----EEEEE-EEEEEE----EEEEEE-----EEEE--EEEEEEEEEE------EEEEEEEE-----EEE----EEEEEEE------EEEEEEEEEEE-------------------------
| | View
Powered by 3Dmol.js.
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington