2019-11-09_00000032_1_11 Domain 1 Parse 1 Confidence: 0.97

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10806CompleteStructure predictioncameo2019-11-09_00000032_1_111179 Nov 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10777110.97comparative modeling7-1171119 Nov 2019
               10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  
   sequence: GSGSTPLKTVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
    psipred: ---------EEE--------EEEEEEE--EE-------------EEEEE------HH--------------EEEE---------HHHH-----------------EEEE--
    spider3: ---------EEEE--------EEEEEE--EEEEE------HHHHHHHHHH----HHHHH------------EEE--------HHHHHH----------------EEEEE--
 deepconcnf: --------EEEEE------EEEEEEEE--EEEEEE-----HHHHHHHHHH---------------------EEEEEEE---------------------------EEEE--
| | View
Powered by 3Dmol.js.


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington