T1020 Domain 4 Parse 1 Confidence: 0.11
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
482 | Complete | Structure prediction | casp | T1020 | 577 | 12 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
692 | 4 | 1 | 0.11 | comparative modeling | 514-577 | 64 | 13 Jul 2018 |
>692
FPNDLAIAITKDRQNGGARPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKTNSADKEEEEKTD
>5nywO_105 weight: 1.0000 score: 18.81 eval: 0.036 prob: n/a identity: 0.0312 startpos: 35
--RTLVVQSAGN---------------LATTQSIVSLLQRR-----------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington