T0958 Domain 1 Parse 1 Confidence: 0.36
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
169 | Complete | Structure prediction | casp | T0958 | 96 | 10 May 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
249 | 1 | 1 | 0.36 | comparative modeling | 1-96 | 96 | 10 May 2018 |
>249
MNKKSKQQEKLYNFIIAKSFQQPVGSTFTYGELRKKYNVVCSTNDQREVGRRFAYWIKYTPGLPFKIVGTKNGSLLYQKIGINPCNNSTPSKGGDC
>1d8jA_304 weight: 1.0000 score: 6.02 eval: n/a prob: n/a identity: 0.0729 startpos: 6
SGYKFGVLAKIVNYMKTRHQRGDTHP-LTLDEILDETQHliGLKQKQWLMTEA---LVNNPK-----IEVIDGKYAFKPKYNVR------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington